PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr003240.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 328aa    MW: 36628.3 Da    PI: 7.9593
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr003240.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.7e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l  +++q+G+++W++I++  g+ R++k+c++rw +yl
      Pbr003240.1 14 RGQWTPEEDNKLSSYIAQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding46.49.2e-1568109245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      g ++  E++++v+++   G++ W++Ia++++ gRt++++k++w+
      Pbr003240.1  68 GQFSDAEEQIIVKLHSIVGNR-WSLIAARLP-GRTDNDVKNHWN 109
                      7899*****************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.358965IPR017930Myb domain
SuperFamilySSF466896.74E-2912108IPR009057Homeodomain-like
SMARTSM007176.0E-141363IPR001005SANT/Myb domain
PfamPF002493.2E-171461IPR001005SANT/Myb domain
CDDcd001673.13E-121761No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129421.09466116IPR017930Myb domain
SMARTSM007172.3E-1366114IPR001005SANT/Myb domain
PfamPF002497.1E-1368109IPR001005SANT/Myb domain
CDDcd001672.88E-1070109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MGRIPCCEKD TVKRGQWTPE EDNKLSSYIA QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SDAEEQIIVK LHSIVGNRWS LIAARLPGRT DNDVKNHWNI KLKKKLSGMG  120
IDPVTHKPFS HLMAEIATTL EPPQAAHLAE SALGFFKDEM LHLLTKKRMD FQLQHINPTP  180
GNSTATYINR KQEEKDGTVE KIKIGLSRAM QEQPDMLNSN KPWTDTTGAT SVNITGNYSP  240
FPLPMSGFQY GHSTFGNEGN GSLWSRSLCT GSTAADQLGQ LHDKLEVEEN GEESTGGKEL  300
RNGSSNIFNS DGLLWDLPSD DLMNQMV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009348787.10.0PREDICTED: transcription repressor MYB4
SwissprotQ7XQN11e-121MYB80_ORYSJ; Transcription factor MYB80
TrEMBLM5WEW70.0M5WEW7_PRUPE; Uncharacterized protein
STRINGVIT_19s0015g01280.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108783039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-118myb domain protein 103